PDB entry 4pm0

View 4pm0 on RCSB PDB site
Description: PDE7A catalytic domain in complex with 2-(Cyclopentylamino)thieno[3,2-d]pyrimidin-4(3H)-one derivative
Class: hydrolase
Keywords: phosphodiesterase, PDE7, HYDROLASE
Deposited on 2014-05-20, released 2014-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE7A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pm0a_
  • Heterogens: ZN, MG, 32V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pm0A (A:)
    gsgmketaaakperqhmdspdlgtddddkamadigssnslnildddyngqakcmlekvgn
    wnfdiflfdrltngnslvsltfhlfslhglieyfhldmmklrrflvmiqedyhsqnpyhn
    avhaadvtqamhcylkepklansvtpwdillsliaaathdldhpgvnqpfliktnhylat
    lykntsvlenhhwrsavgllresglfshlplesrqqmetqigalilatdisrqneylslf
    rshldrgdlcledtrhrhlvlqmalkcadicnpcrtwelskqwsekvteeffhqgdiekk
    yhlgvsplcdrhtesianiqigfmtylveplftewarfsntrlsqtmlghvglnkaswkg
    lqreqsssedtdaafelnsqllpqenrls
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pm0A (A:)
    dyngqakcmlekvgnwnfdiflfdrltngnslvsltfhlfslhglieyfhldmmklrrfl
    vmiqedyhsqnpyhnavhaadvtqamhcylkepklansvtpwdillsliaaathdldhpg
    vnqpfliktnhylatlykntsvlenhhwrsavgllresglfshlplesrqqmetqigali
    latdisrqneylslfrshldrgdlcledtrhrhlvlqmalkcadicnpcrtwelskqwse
    kvteeffhqgdiekkyhlgvsplcdrhtesianiqigfmtylveplftewarfsntrlsq
    tmlghvglnkaswkglqr