PDB entry 4plq

View 4plq on RCSB PDB site
Description: crystal structures of designed armadillo repeat proteins: implications of construct design and crystallization conditions on overall structure.
Deposited on 2014-05-19, released 2014-08-27
The last revision was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arm00011
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PLQ (0-283)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4plqA (A:)
gpgselpqmvqqlnspdqqelqsalrklsqiasggneqiqavidagalpalvqllsspne
qilqealwtlgniasggneqiqavidagalpalvqllsspneqilqealwtlgniasggn
eqiqavidagalpalvqllsspneqilqealwtlgniasggneqiqavidagalpalvql
lsspneqilqealwtlgniasggneqiqavidagalpalvqllsspneqilqealwtlgn
iasggneqkqavkeagaepaleqlqsspnekiqkeaqealekiq