PDB entry 4pli

View 4pli on RCSB PDB site
Description: Structure of the chromodomain of MRG2 in complex with H3K36me3
Class: transcription
Keywords: chromodamian, H3k36me3, TRANSCRIPTION
Deposited on 2014-05-18, released 2015-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: At1g02740
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g02740
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4plia_
  • Chain 'B':
    Compound: At1g02740
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g02740
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4plib_
  • Chain 'C':
    Compound: H3K36me3
    Species: ARABIDOPSIS THALIANA [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PLI
  • Chain 'D':
    Compound: H3K36me3
    Species: ARABIDOPSIS THALIANA [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • PDB 4PLI
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pliA (A:)
    gshfeegervlakhsdcfyeakvlkvefkdnewkyfvhyigwnkswdewirldcllkhsd
    eniekqkeqglkqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pliA (A:)
    hfeegervlakhsdcfyeakvlkvefkdnewkyfvhyigwnkswdewirldcllkhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pliB (B:)
    gshfeegervlakhsdcfyeakvlkvefkdnewkyfvhyigwnkswdewirldcllkhsd
    eniekqkeqglkqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pliB (B:)
    hfeegervlakhsdcfyeakvlkvefkdnewkyfvhyigwnkswdewirldcllkhs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.