PDB entry 4pkr

View 4pkr on RCSB PDB site
Description: Anthrax toxin lethal factor with bound small molecule inhibitor 10
Class: hydrolase/hydrolase inhibitor
Keywords: Anthrax toxin, lethal factor, metalloproteinase, metalloprotease, structural dynamics, ligand-induced conformational change, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-05-15, released 2014-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lethal Factor
    Species: Bacillus anthracis [TaxId:1392]
    Gene: lef, pXO1-107, BXA0172, GBAA_pXO1_0172
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pkra1
  • Heterogens: 2ZL, ZN, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pkrA (A:)
    snalsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkr
    iqidssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkl
    diqpydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenm
    ninnltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkw
    riqlspdtragylengklilqrnigleikdvqiikqsekeyiridakvvpkskidtkiqe
    aqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknniqsdlikkvtny
    lvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhgpskgvelrnds
    egfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygrtneaeffaeaf
    rlmhstdhaerlkvqknapktfqfindqikfiinslvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pkrA (A:)
    ryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqids
    sdflsteekeflkklqidirdslseelsekekeflkklkldiqpydinqrlqdtgglids
    psinldvrkqykrdiqnidallhqsigstlynkiylyenmninnltatlgadlvdstdnt
    kinrgifnefkknfkysissnymivdinerpaldnerlkwriqlspdtragylengklil
    qrnigleikdvqiikqsekeyiridakvvpkskidtkiqeaqlninqewnkalglpkytk
    litfnvhnryasnivesaylilnewknniqsdlikkvtnylvdgngrfvftditlpniae
    qythqdeiyeqvhskglyvpesrsillhgpskgvelrndsegfihefghavddyagylld
    knqsdlvtnskkfidifkeegsnltsygrtneaeffaeafrlmhstdhaerlkvqknapk
    tfqfindqikfiins