PDB entry 4pj6

View 4pj6 on RCSB PDB site
Description: Crystal Structure of Human Insulin Regulated Aminopeptidase with Lysine in Active Site
Class: Hydrolase
Keywords: Aminopeptidase, Metalloprotease, Hydrolase
Deposited on 2014-05-12, released 2014-12-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: 0.189
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucyl-cystinyl aminopeptidase
    Species: Homo sapiens [TaxId:9606]
    Gene: LNPEP, OTASE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4pj6a1, d4pj6a2, d4pj6a3, d4pj6a4
  • Chain 'B':
    Compound: Leucyl-cystinyl aminopeptidase
    Species: Homo sapiens [TaxId:9606]
    Gene: LNPEP, OTASE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4pj6b1, d4pj6b2, d4pj6b3, d4pj6b4
  • Heterogens: ZN, LYS, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pj6A (A:)
    satngklfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstg
    hnisrvtfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyyg
    fygfsytdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpk
    kssvvlddglvqdefsesvkmstylvafivgemknlsqdvngtlvsiyavpekigqvhya
    lettvklleffqnyfeiqyplkkldlvaipdfeagamenwglltfreetllydsntssma
    drklvtkiiahelahqwfgnlvtmkwwndlwlnegfatfmeyfslekifkelssyedfld
    arfktmkkdslnsshpisssvqsseqieemfdslsyfkgsslllmlktylsedvfqhavv
    lylhnhsyasiqsddlwdsfnevtnqtldvkrmmktwtlqkgfplvtvqkkgkelfiqqe
    rfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslldkksgvinlteevlwvkvn
    inmngyyivhyadddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdli
    nylgnenhtapitealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegt
    psmrelrsallefacthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkg
    wsfllgkyisigseaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgr
    hfpghllawdfvkenwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqsea
    tfrlrcvqealeviqlniqwmeknlksltwwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj6A (A:)
    klfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisr
    vtfmsvssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfsy
    tdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvvl
    ddglvqdefsesvkmstylvafivgemknlsqdvngtlvsiyavpekigqvhyalettvk
    lleffqnyfeiqyplkkldlvaipdfeagamenwglltfreetllydsntssmadrklvt
    kiiahelahqwfgnlvtmkwwndlwlnegfatfmeyfslekifkelssyedfldarfktm
    kkdslnsshpisssvqsseqieemfdslsyfkgsslllmlktylsedvfqhavvlylhnh
    syasiqsddlwdsfnevtnqtldvkrmmktwtlqkgfplvtvqkkgkelfiqqerfflnm
    sdtsylwhiplsyvtegrnyskyqsvslldkksgvinlteevlwvkvninmngyyivhya
    dddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdlinylgnenhtapi
    tealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegtpsmrelrsalle
    facthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkgwsfllgkyisig
    seaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgrhfpghllawdfv
    kenwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqseatfrlrcvqeale
    viqlniqwmeknlksltwwl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pj6B (B:)
    satngklfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstg
    hnisrvtfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyyg
    fygfsytdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpk
    kssvvlddglvqdefsesvkmstylvafivgemknlsqdvngtlvsiyavpekigqvhya
    lettvklleffqnyfeiqyplkkldlvaipdfeagamenwglltfreetllydsntssma
    drklvtkiiahelahqwfgnlvtmkwwndlwlnegfatfmeyfslekifkelssyedfld
    arfktmkkdslnsshpisssvqsseqieemfdslsyfkgsslllmlktylsedvfqhavv
    lylhnhsyasiqsddlwdsfnevtnqtldvkrmmktwtlqkgfplvtvqkkgkelfiqqe
    rfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslldkksgvinlteevlwvkvn
    inmngyyivhyadddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdli
    nylgnenhtapitealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegt
    psmrelrsallefacthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkg
    wsfllgkyisigseaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgr
    hfpghllawdfvkenwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqsea
    tfrlrcvqealeviqlniqwmeknlksltwwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj6B (B:)
    lfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisrv
    tfmekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfsytdesne
    kkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvvlddglvq
    defsesvkmstylvafivgemknlsqdvngtlvsiyavpekigqvhyalettvklleffq
    nyfeiqyplkkldlvaipdfeagamenwglltfreetllydsntssmadrklvtkiiahe
    lahqwfgnlvtmkwwndlwlnegfatfmeyfslekifkelssyedfldarfktmkkdsln
    sshpisssvqsseqieemfdslsyfkgsslllmlktylsedvfqhavvlylhnhsyasiq
    sddlwdsfnevtnqtldvkrmmktwtlqkgfplvtvqkkgkelfiqqerfflntsylwhi
    plsyvtenyskyqsvslldkksgvinlteevlwvkvninmngyyivhyadddwealihql
    kinpyvlsdkdranlinnifelaglgkvplkrafdlinylgnenhtapitealfqtdliy
    nlleklgymdlasrlvtrvfkllqnqiqqqtwtdegtpsmrelrsallefacthnlgncs
    ttamklfddwmasngtqslptdvmttvfkvgaktdkgwsfllgkyisigseaeknkilea
    lassedvrklywlmksslngdnfrtqklsfiirtvgrhfpghllawdfvkenwnklvqkf
    plgsytiqnivagstylfstkthlsevqaffenqseatfrlrcvqealeviqlniqwmek
    nlksltwwl