PDB entry 4pj0

View 4pj0 on RCSB PDB site
Description: Structure of T.elongatus Photosystem II, rows of dimers crystal packing
Class: oxidoreductase, electron transport
Keywords: Membrane Protein, Photosystem II, C12E8, OXIDOREDUCTASE, ELECTRON TRANSPORT
Deposited on 2014-05-10, released 2014-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.218
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: photosystem q(b) protein 1
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0a_
  • Chain 'B':
    Compound: CP47 protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0b_
  • Chain 'C':
    Compound: Photosystem II CP43 protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0c_
  • Chain 'D':
    Compound: Photosystem II D2 protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0d_
  • Chain 'E':
    Compound: Cytochrome b559 subunit alpha
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0e_
  • Chain 'F':
    Compound: Cytochrome b559 subunit beta
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0f_
  • Chain 'H':
    Compound: Photosystem II reaction center protein H
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0h_
  • Chain 'I':
    Compound: Photosystem II reaction center protein I
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0i_
  • Chain 'J':
    Compound: Photosystem II reaction center protein J
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0j_
  • Chain 'K':
    Compound: Photosystem II reaction center protein K
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Photosystem II reaction center protein L
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0l_
  • Chain 'M':
    Compound: Photosystem II reaction center protein M
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0m_
  • Chain 'O':
    Compound: Photosystem II manganese-stabilizing polypeptide
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0o_
  • Chain 'R':
    Compound: Photosystem II protein Y
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Photosystem II reaction center protein T
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0t_
  • Chain 'U':
    Compound: Photosystem II 12 kDa extrinsic protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0u_
  • Chain 'V':
    Compound: cytochrome c-550
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0v_
  • Chain 'X':
    Compound: Photosystem II reaction center X protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0x_
  • Chain 'Y':
    Compound: Photosystem II reaction center protein ycf12
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Photosystem II reaction center protein Z
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pj0z_
  • Chain 'a':
    Compound: photosystem q(b) protein 1
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: CP47 protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Photosystem II CP43 protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Photosystem II D2 protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Cytochrome b559 subunit alpha
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: Cytochrome b559 subunit beta
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Photosystem II reaction center protein H
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Photosystem II reaction center protein I
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Photosystem II reaction center protein J
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Photosystem II reaction center protein K
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Photosystem II reaction center protein L
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Photosystem II reaction center protein M
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: Photosystem II manganese-stabilizing polypeptide
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: Photosystem II protein Y
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: Photosystem II reaction center protein T
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: Photosystem II 12 kDa extrinsic protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: cytochrome c-550
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: Photosystem II reaction center X protein
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'y':
    Compound: Photosystem II reaction center protein ycf12
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'z':
    Compound: Photosystem II reaction center protein Z
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: OEX, FE, LMG, CL, CLA, BCR, PL9, SQD, LHG, SO4, BCT, UNL, DGD, PHO, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pj0A (A:)
    mtttlqrresanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdi
    dgirepvsgsllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfl
    lgascymgrqwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtf
    nfmivfqaehnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfg
    qeeetynivaahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngf
    nfnhsvidakgnvintwadiinranlgmevmhernahnfpldla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0A (A:)
    nlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgsl
    lygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrqw
    elsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaehn
    ilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetynivaa
    hgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidakg
    nvintwadiinranlgmevmhernahnfpldla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pj0B (B:)
    mglpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgm
    fvlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdl
    elfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqp
    vapewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlss
    siaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatlee
    awsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmp
    affesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksy
    arkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfs
    gidpelspeqvewgfyqkvgdvttrrkeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0B (B:)
    glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
    vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
    lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
    apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
    iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
    wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
    ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
    rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
    idpelspeqvewgfyqkvgdvttrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4pj0C (C:)
    mvtlssnsifatnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfel
    ahfipekpmyeqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyh
    airgpetleeyssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapg
    ggdvrvitnptldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhi
    lttpfgwarrafiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqa
    qamtflirdqklganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgp
    ngldlnkikndiqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfv
    laffflvghlwhagraraaaagfekgidresepvlsmpsld
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0C (C:)
    rdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqg
    liliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyss
    ffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptld
    prvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafi
    wsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklg
    anvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiq
    pwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwha
    graraaaagfekgidresepvlsmpsld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4pj0D (D:)
    mtiaigrapaergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswyt
    hglassylegcnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgaf
    gligfmlrqfeiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifr
    fllffqgfhnwtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqa
    eetysmvtanrfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfis
    qeiraaedpefetfytknlllnegirawmapqdqphenfvfpeevlprgnal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0D (D:)
    gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn
    fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei
    arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt
    lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf
    wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe
    tfytknlllnegirawmapqdqphenfvfpeevlprgnal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4pj0E (E:)
    magttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeq
    rsiplvtdrfeakqqvetfleqlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0E (E:)
    agttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqr
    siplvtdrfeakqqvetfleql
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4pj0F (F:)
    mtsntpnqepvsypiftvrwvavhtlavptifflgaiaamqfiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0F (F:)
    ypiftvrwvavhtlavptifflgaiaamqfiqr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4pj0H (H:)
    marrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnv
    swkalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0H (H:)
    arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
    wka
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4pj0I (I:)
    metlkitvyivvtffvllfvfgflsgdparnpkrkdle
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0I (I:)
    metlkitvyivvtffvllfvfgflsgdparnpk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4pj0J (J:)
    mmseggriplwivatvagmgvivivglffygayaglgssl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0J (J:)
    riplwivatvagmgvivivglffygayaglgssl
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4pj0L (L:)
    mepnpnrqpvelnrtslylglllilvlallfssyffn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0L (L:)
    epnpnrqpvelnrtslylglllilvlallfssyffn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4pj0M (M:)
    mevnqlgliatalfvlvpsvfliilyvqtesqqkss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0M (M:)
    mevnqlgliatalfvlvpsvfliilyvqtesq
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4pj0O (O:)
    mkyrilmatllavclgifslsapafaakqtltyddivgtglankcptlddtargaypids
    sqtyriarlclqpttflvkeepknkrqeaefvptklvtrettsldqiqgelkvnsdgslt
    fveedgidfqpvtvqmaggeripllftvknlvastqpnvtsittstdfkgefnvpsyrta
    nfldpkgrglasgydsaialpqakeeelaranvkrfsltkgqislnvakvdgrtgeiagt
    feseqlsdddmgahephevkiqgvfyasiepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0O (O:)
    tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
    efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
    nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
    ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
    ep
    

  • Chain 'R':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4pj0T (T:)
    metityvfifaciialfffaiffreppritkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0T (T:)
    metityvfifaciialfffaiffreppri
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4pj0U (U:)
    mqrlgrwlalayfvgvsllgwinwsaptlaatasteeelvnvvdeklgtaygekidlnnt
    niaafiqyrglyptlaklivknapyesvedvlnipglterqkqilrenlehftvteveta
    lveggdrynnglyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0U (U:)
    lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt
    erqkqilrenlehftvtevetalveggdrynnglyk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4pj0V (V:)
    mlkkcvwlavalclclwqftmgtalaaeltpevltvplnsegktitltekqylegkrlfq
    yacaschvggitktnpsldlrtetlalatpprdnieglvdymknpttydgeqeiaevhps
    lrsadifpkmrnltekdlvaiaghilvepkilgdkwgggkvyy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0V (V:)
    aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
    latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
    vepkilgdkwgggkvyy
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4pj0X (X:)
    mtitpslkgffigllsgavvlgltfavliaisqidkvqrsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pj0X (X:)
    titpslkgffigllsgavvlgltfavliaisqidkvq
    

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pj0Z (Z:)
    mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
    vv
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 'r':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'u':
    No sequence available.

  • Chain 'v':
    No sequence available.

  • Chain 'x':
    No sequence available.

  • Chain 'y':
    No sequence available.

  • Chain 'z':
    No sequence available.