PDB entry 4piw

View 4piw on RCSB PDB site
Description: Crystal structure of sugar aminotransferase WecE from Escherichia coli K-12
Class: transferase
Keywords: sugar aminotransferase, Structural Genomics, PSI-Biology, Protein Structure Initiative, Enzyme Discovery for Natural Product Biosynthesis, NatPro, TRANSFERASE
Deposited on 2014-05-09, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TDP-4-keto-6-deoxy-D-glucose transaminase family protein
    Species: Escherichia coli [TaxId:83333]
    Gene: wecE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4piwa_
  • Chain 'B':
    Compound: TDP-4-keto-6-deoxy-D-glucose transaminase family protein
    Species: Escherichia coli [TaxId:83333]
    Gene: wecE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4piwb_
  • Chain 'C':
    Compound: TDP-4-keto-6-deoxy-D-glucose transaminase family protein
    Species: Escherichia coli [TaxId:83333]
    Gene: wecE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4piwc_
  • Chain 'D':
    Compound: TDP-4-keto-6-deoxy-D-glucose transaminase family protein
    Species: Escherichia coli [TaxId:83333]
    Gene: wecE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4piwd_
  • Chain 'E':
    Compound: TDP-4-keto-6-deoxy-D-glucose transaminase family protein
    Species: Escherichia coli [TaxId:83333]
    Gene: wecE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4piwe_
  • Chain 'F':
    Compound: TDP-4-keto-6-deoxy-D-glucose transaminase family protein
    Species: Escherichia coli [TaxId:83333]
    Gene: wecE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4piwf_
  • Chain 'G':
    Compound: TDP-4-keto-6-deoxy-D-glucose transaminase family protein
    Species: Escherichia coli [TaxId:83333]
    Gene: wecE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4piwg_
  • Chain 'H':
    Compound: TDP-4-keto-6-deoxy-D-glucose transaminase family protein
    Species: Escherichia coli [TaxId:83333]
    Gene: wecE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4piwh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4piwA (A:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4piwA (A:)
    pfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctaslema
    allldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdktrv
    ivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhetkn
    ytaggeggatlindkalieraeiirekgtnwrdigssylmsdlqaaylwaqleaadrinq
    qrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinflkeaei
    mavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtviatllnyf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4piwB (B:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4piwB (B:)
    mipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasle
    maallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdkt
    rvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhet
    knytaggeggatlindkalieraeiirekgtnwrdigssylmsdlqaaylwaqleaadri
    nqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinflkea
    eimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtviatlln
    yf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4piwC (C:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4piwC (C:)
    ipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctaslem
    aallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdktr
    vivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhetk
    nytaggeggatlindkalieraeiirekgtnwrdigssylmsdlqaaylwaqleaadrin
    qqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinflkeae
    imavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtviatllny
    fs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4piwD (D:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4piwD (D:)
    ipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctaslem
    aallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdktr
    vivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhetk
    nytaggeggatlindkalieraeiirekgtnwrdigssylmsdlqaaylwaqleaadrin
    qqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinflkeae
    imavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtviatllny
    f
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4piwE (E:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4piwE (E:)
    mipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasle
    maallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdkt
    rvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhet
    knytaggeggatlindkalieraeiirekgtnwrdigssylmsdlqaaylwaqleaadri
    nqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinflkea
    eimavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtviatlln
    yf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4piwF (F:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4piwF (F:)
    pfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctaslema
    allldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdktrv
    ivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhetkn
    ytaggeggatlindkalieraeiirekgtnrdigssylmsdlqaaylwaqleaadrinqq
    rlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinflkeaeim
    avfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtviatllnyf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4piwG (G:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4piwG (G:)
    mipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasle
    maallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdkt
    rvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhet
    knytaggeggatlindkalieraeiirekgtnrdigssylmsdlqaaylwaqleaadrin
    qqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinflkeae
    imavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtviatllny
    f
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4piwH (H:)
    mgsshhhhhhssglvprgshmipfnappvvgteldymqsamgsgklcgdggftrrcqqwl
    eqrfgsakvlltpsctaslemaallldiqpgdevimpsytfvstanafvlrgakivfvdv
    rpdtmnidetlieaaitdktrvivpvhyagvacemdtimalakkhnlfvvedaaqgvmst
    ykgralgtighigcfsfhetknytaggeggatlindkalieraeiirekgtnrsqffrgq
    vdkytwrdigssylmsdlqaaylwaqleaadrinqqrlalwqnyydalaplakagrielp
    sipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhged
    ryttkeserllrlplfynlspvnqrtviatllnyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4piwH (H:)
    mipfnappvvgteldymqsamgsgklcgdggftrrcqqwleqrfgsakvlltpsctasle
    maallldiqpgdevimpsytfvstanafvlrgakivfvdvrpdtmnidetlieaaitdkt
    rvivpvhyagvacemdtimalakkhnlfvvedaaqgvmstykgralgtighigcfsfhet
    knytaggeggatlindkalieraeiirekgtnrdigssylmsdlqaaylwaqleaadrin
    qqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinflkeae
    imavfhyiplhgcpagehfgefhgedryttkeserllrlplfynlspvnqrtviatllny
    f