PDB entry 4pit

View 4pit on RCSB PDB site
Description: Crystal Structure of Banana Lectin H84T bound to dimannose
Class: sugar binding protein
Keywords: lectin, SUGAR BINDING PROTEIN
Deposited on 2014-05-09, released 2015-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ripening-associated protein
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22321 (Start-140)
      • engineered mutation (83)
      • expression tag (141-142)
    Domains in SCOPe 2.06: d4pita1, d4pita2
  • Chain 'B':
    Compound: ripening-associated protein
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22321 (0-140)
      • engineered mutation (83)
      • expression tag (141-143)
    Domains in SCOPe 2.06: d4pitb1, d4pitb2
  • Chain 'C':
    Compound: ripening-associated protein
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22321 (Start-140)
      • engineered mutation (83)
      • expression tag (141-142)
    Domains in SCOPe 2.06: d4pitc1, d4pitc2
  • Chain 'D':
    Compound: ripening-associated protein
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22321 (0-140)
      • engineered mutation (83)
      • expression tag (141-142)
    Domains in SCOPe 2.06: d4pitd1, d4pitd2
  • Heterogens: MAN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pitA (A:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanytgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvyleplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pitA (A:)
    aikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsggtph
    eivlqegeylvgmagevanytgavvlgklgfstnkkaygpfgntggtpfslpiaagkisg
    ffgrggkfldaigvyleple
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pitB (B:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanytgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvyleplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pitB (B:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanytgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvylepleh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4pitC (C:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanytgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvyleplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pitC (C:)
    gaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsggtp
    heivlqegeylvgmagevanytgavvlgklgfstnkkaygpfgntggtpfslpiaagkis
    gffgrggkfldaigvyleple
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4pitD (D:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanytgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvyleplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pitD (D:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanytgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvyleple