PDB entry 4piq

View 4piq on RCSB PDB site
Description: crystal structure of human adenovirus 8 protease with a nitrile inhibitor
Deposited on 2014-05-09, released 2014-09-10
The last revision was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human adenovirus 8 [TaxId:31545]
    Gene: L3
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: pvi
    Species: Human adenovirus 8, synthetic [TaxId:31545]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 3FS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4piqA (A:)
sgsseqelaaivrdlgcgpyflgthdkrfpgflagnklacaivntagretggvhwlafgw
nprsrtcymfdpfgfsdrrlkqiysfeyeamlrrsalalspdrclsleqstqtvqgpdsa
acglfccmflhafvhwpdrpmdgnptmnlltgvpngmlqspqvlptlrrnqeklyrflah
hspyfrshraaiehatafdkmkql

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >4piqB (B:)
gvkslkrrrcy