PDB entry 4pij

View 4pij on RCSB PDB site
Description: X-ray crystal structure of the K11S/K63S double mutant of ubiquitin
Class: protein binding
Keywords: entropy-reduction, mutant, PROTEIN BINDING
Deposited on 2014-05-08, released 2014-10-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62987 (0-74)
      • engineered mutation (10)
      • engineered mutation (62)
    Domains in SCOPe 2.08: d4pija_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62987 (0-74)
      • engineered mutation (10)
      • engineered mutation (62)
    Domains in SCOPe 2.08: d4pijb_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4pijA (A:)
mqifvktltgstitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqsestlhlvlrlrg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4pijB (B:)
mqifvktltgstitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqsestlhlvlrlrg