PDB entry 4pii

View 4pii on RCSB PDB site
Description: Crystal structure of hypothetical protein PF0907 from pyrococcus furiosus solved by sulfur SAD using Swiss light source data
Class: unknown function
Keywords: sulfur sad, southeast collaboratory for structural genomics, structural genomics, unknown function, secsg
Deposited on 2014-05-08, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-glycosylase/DNA lyase
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: PF0904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4piia_
  • Heterogens: CL, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4piiA (A:)
    ahhhhhhgsrelveiikgigiegakeveekvdrqfyalqylfrhqdpemfiklvianslv
    syqltgrgedwwwefaryfsgrevdsiwkaygeflpksknnrrlieaklnrirkvegfls
    tltlkdlegyyknmkmlwkalikimgsredsktivftvkmfgyasriafsrfipypmeip
    ipedlriksvtskltqekptkfwmkigqesgvpplhidsliwpllgnadltpldielrnk
    lmkltellgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4piiA (A:)
    elveiikgigiegakeveekvdrqfyalqylfrhqdpemfiklvianslvsyqltgrged
    wwwefaryfsgrevdsiwkaygeflpksknnrrlieaklnrirkvegflstltlkdlegy
    yknmkmlwkalikimgsredsktivftvkmfgyasriafsrfipypmeipipedlriksv
    tskltqekptkfwmkigqesgvpplhidsliwpllgnadltpldielrnklmkltellg