PDB entry 4pig

View 4pig on RCSB PDB site
Description: Crystal structure of the ubiquitin K11S mutant
Class: protein binding
Keywords: entropy-reduction, mutant, PROTEIN BINDING
Deposited on 2014-05-08, released 2014-10-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.171
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62987 (0-End)
    • engineered mutation (10)
• Chain 'B':
  Compound: Ubiquitin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62987 (0-75)
    • engineered mutation (10)
• Chain 'C':
  Compound: Ubiquitin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62987 (0-End)
    • engineered mutation (10)
• Chain 'D':
  Compound: Ubiquitin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62987 (0-75)
    • engineered mutation (10)
  Domains in SCOPe 2.04: d4pigd_
• Heterogens: CA, CL, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4pigD (D:)
  mqifvktltgstitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhlvlrlrgg