PDB entry 4pif

View 4pif on RCSB PDB site
Description: Crystal Structure of recombinant WT Banana Lectin
Class: sugar binding protein
Keywords: lectin, SUGAR BINDING PROTEIN
Deposited on 2014-05-08, released 2015-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ripening-associated protein
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22321 (Start-140)
      • expression tag (141)
    Domains in SCOPe 2.06: d4pifa1, d4pifa2
  • Chain 'B':
    Compound: ripening-associated protein
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22321 (0-140)
      • expression tag (141)
    Domains in SCOPe 2.06: d4pifb1, d4pifb2
  • Chain 'C':
    Compound: ripening-associated protein
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22321 (Start-140)
      • expression tag (141)
    Domains in SCOPe 2.06: d4pifc1, d4pifc2
  • Chain 'D':
    Compound: ripening-associated protein
    Species: MUSA ACUMINATA [TaxId:4641]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22321 (0-140)
      • expression tag (141)
    Domains in SCOPe 2.06: d4pifd1, d4pifd2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pifA (A:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvyleplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pifA (A:)
    aikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsggtph
    eivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagkisg
    ffgrggkfldaigvylepl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pifB (B:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvyleplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pifB (B:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvylepl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4pifC (C:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvyleplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pifC (C:)
    aikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsggtph
    eivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagkisg
    ffgrggkfldaigvylepl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4pifD (D:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvyleplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pifD (D:)
    mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
    tpheivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagk
    isgffgrggkfldaigvylepl