PDB entry 4phw

View 4phw on RCSB PDB site
Description: Crystal Structure of PDE10A with 1H-benzimidazol-2-yl(4-((3-(tetrahydro-2H-pyran-4-yl)-2-pyridinyl)oxy)phenyl)methanone
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Inhibitor, Phosphodiesterase, keto-benzimidazole, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2014-05-07, released 2014-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.161
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4phwa_
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4phwb_
  • Heterogens: ZN, SO4, 2W1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4phwA (A:)
    mkhhhhhhhdevdtseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrsc
    gtscfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglli
    aclchdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssse
    yeqvleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsv
    tklwpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcy
    ttltqilpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4phwA (A:)
    lpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyrrvp
    yhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdhpla
    alyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnrk
    qleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegdem
    kklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnlsqwe
    kvirg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4phwB (B:)
    mkhhhhhhhdevdtseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrsc
    gtscfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglli
    aclchdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssse
    yeqvleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsv
    tklwpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcy
    ttltqilpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >4phwB (B:)
    lpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyrrvp
    yhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdhpla
    alyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnrk
    qleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegdem
    kklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnlsqwe
    kvirg