PDB entry 4phn

View 4phn on RCSB PDB site
Description: The Structural Basis of Differential Inhibition of Human Calpain by Indole and Phenyl alpha-Mercaptoacrylic Acids
Class: hydrolase
Keywords: Calcium Binding, Protease, hydrolase
Deposited on 2014-05-06, released 2014-08-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calpain small subunit 1
    Species: Sus scrofa [TaxId:9823]
    Gene: CAPNS1, CAPN4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4phna_
  • Chain 'B':
    Compound: Calpain small subunit 1
    Species: Sus scrofa [TaxId:9823]
    Gene: CAPNS1, CAPN4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4phnb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4phnA (A:)
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4phnB (B:)
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys