PDB entry 4pgm

View 4pgm on RCSB PDB site
Description: saccharomyces cerevisiae phosphoglycerate mutase
Deposited on 1997-04-25, released 1997-10-29
The last revision prior to the SCOP 1.59 freeze date was dated 1997-10-29, with a file datestamp of 1997-10-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d4pgma_
  • Chain 'B':
    Domains in SCOP 1.59: d4pgmb_
  • Chain 'C':
    Domains in SCOP 1.59: d4pgmc_
  • Chain 'D':
    Domains in SCOP 1.59: d4pgmd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pgmA (A:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pgmB (B:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaag
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pgmC (C:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pgmD (D:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaag