PDB entry 4pgf

View 4pgf on RCSB PDB site
Description: the structure of mono-acetylated sahh
Deposited on 2014-05-01, released 2014-10-01
The last revision was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylhomocysteinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AHCY, SAHH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23526 (Start-431)
      • variant (85)
      • engineered mutation (395)
  • Chain 'B':
    Compound: Adenosylhomocysteinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AHCY, SAHH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23526 (Start-431)
      • variant (85)
      • engineered mutation (395)
  • Heterogens: NAD, ADN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4pgfA (A:)
    msdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvet
    avlietlvtlgaevqwsscnifstqnhaaaaiakagipvyawkgetdeeylwcieqtlyf
    kdgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainv
    ndsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvi
    iteidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnig
    hfdveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsn
    sftnqvmaqielwthpdkypvgvhflpkkldeavacahlgklnvkltkltekqaqylgms
    cdgpfkpdhyry
    

    Sequence, based on observed residues (ATOM records):
    >4pgfA (A:)
    dklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvetav
    lietlvtlgaevqwsscnifstqnhaaaaiakagipvyawkgetdeeylwcieqtlyfkd
    gplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavacahlgklnvkltkltekqaqylgmscd
    gpfkpdhyry
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4pgfB (B:)
    msdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvet
    avlietlvtlgaevqwsscnifstqnhaaaaiakagipvyawkgetdeeylwcieqtlyf
    kdgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainv
    ndsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvi
    iteidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnig
    hfdveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsn
    sftnqvmaqielwthpdkypvgvhflpkkldeavacahlgklnvkltkltekqaqylgms
    cdgpfkpdhyry
    

    Sequence, based on observed residues (ATOM records):
    >4pgfB (B:)
    lpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvetavli
    etlvtlgaevqwsscnifstqnhaaaaiakagipvyawkgetdeeylwcieqtlyfkdgp
    lnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainvndsv
    tkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviitei
    dpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnighfdv
    eidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsnsftn
    qvmaqielwthpdkypvgvhflpkkldeavacahlgklnvkltkltekqaqylgmscdgp
    fkpdhyry