PDB entry 4pg3

View 4pg3 on RCSB PDB site
Description: Crystal structure of KRS complexed with inhibitor
Class: ligase/ligase inhibitor
Keywords: Inhibitor, KRS, Complex, LIGASE-LIGASE INHIBITOR complex
Deposited on 2014-05-01, released 2014-07-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.196
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine--tRNA ligase
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF13_0262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pg3a1, d4pg3a2
  • Chain 'B':
    Compound: Lysine--tRNA ligase
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF13_0262
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Lysine--tRNA ligase
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF13_0262
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Lysine--tRNA ligase
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF13_0262
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pg3d1, d4pg3d2
  • Heterogens: LYS, KRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pg3A (A:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pg3A (A:)
    prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
    mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
    kkgelsifpketillsaclhmlpmkyglteiryrqryldllinessrhtfvtrtkiinfl
    rnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmlivggidk
    vyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisyn
    kdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpn
    pptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkev
    lnaytelndpfkqkecfldsafctsleyglpptgglglgidritmfltnknsikdvilfp
    tmrp
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4pg3D (D:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pg3D (D:)
    prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
    mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
    kkgelsifpketillsaclhmlpmkyglteiryrqryldllinessrhtfvtrtkiinfl
    rnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmlivggidk
    vyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisyn
    kdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpn
    pptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkev
    lnaytelndpfkqkecfldsafctsleyglpptgglglgidritmfltnknsikdvilfp
    tmrp