PDB entry 4pfy

View 4pfy on RCSB PDB site
Description: Crystal structure of mannohexaose bound oligopeptide ABC transporter, periplasmic oligopeptide-binding protein (TM1223) from THERMOTOGA MARITIMA at 1.5 A resolution
Class: transport protein
Keywords: oligopeptide ABC transporter, periplasmic oligopeptide-binding protein, TRANSPORT PROTEIN
Deposited on 2014-05-01, released 2014-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC transporter substrate-binding protein
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM_1223, THEMA_08215, Tmari_1230
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0V0 (1-537)
      • expression tag (538-539)
    Domains in SCOPe 2.07: d4pfya1, d4pfya2
  • Chain 'B':
    Compound: ABC transporter substrate-binding protein
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM_1223, THEMA_08215, Tmari_1230
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0V0 (Start-537)
      • expression tag (538)
    Domains in SCOPe 2.07: d4pfyb1, d4pfyb2
  • Heterogens: MG, BMA, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pfyA (A:)
    mtfernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndkfepwlaekg
    ewvsnneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwlgriervder
    tlkfvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpyyveswaddr
    cvfkkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnfflpgvpvlkka
    ygivtwyenapymlpantagiyinvnkyplsipefrramayainpekivtrayenmvtaa
    npagilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfredpngkpfkl
    tiecpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdlilnnfttgvs
    atiwsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakikevvaklsei
    llkdlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgiktlfgieakhh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pfyA (A:)
    tfernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndkfepwlaekge
    wvsnneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwlgriervdert
    lkfvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpyyveswaddrc
    vfkkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnfflpgvpvlkkay
    givtwyenapymlpantagiyinvnkyplsipefrramayainpekivtrayenmvtaan
    pagilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfredpngkpfklt
    iecpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdlilnnfttgvsa
    tiwsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakikevvaklseil
    lkdlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgiktlfgieakhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pfyB (B:)
    mtfernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndkfepwlaekg
    ewvsnneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwlgriervder
    tlkfvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpyyveswaddr
    cvfkkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnfflpgvpvlkka
    ygivtwyenapymlpantagiyinvnkyplsipefrramayainpekivtrayenmvtaa
    npagilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfredpngkpfkl
    tiecpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdlilnnfttgvs
    atiwsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakikevvaklsei
    llkdlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgiktlfgieakhh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pfyB (B:)
    fernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndkfepwlaekgew
    vsnneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwlgriervdertl
    kfvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpyyveswaddrcv
    fkkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnfflpgvpvlkkayg
    ivtwyenapymlpantagiyinvnkyplsipefrramayainpekivtrayenmvtaanp
    agilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfredpngkpfklti
    ecpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdlilnnfttgvsat
    iwsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakikevvaklseill
    kdlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgiktlfgieakh