PDB entry 4pfx

View 4pfx on RCSB PDB site
Description: the highly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold
Deposited on 2014-04-30, released 2014-07-23
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative glycosyltransferase (GalT1)
    Species: Streptococcus parasanguinis [TaxId:1114965]
    Gene: galT1, Spaf_1933
    Database cross-references and differences (RAF-indexed):
    • Uniprot I1ZPA1 (5-276)
      • expression tag (0-4)
  • Heterogens: UDP, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4pfxA (A:)
sefasmkrlseikvlpileslkyikhnhasvvrfgdgeidlmtghsipyqdyneklakrl
qqilqtksdekllvclpdvfsnmdrynqnarhfwerhflkysefylnccdapfygstfis
rpyidlidkspseayfeslkelwrgkdllivegatsrsgvgndlfvaassikrlvcpskn
afqyydeilrlteknaknrlilvmlgptakvlvadlttkgyqaidlghidseyewyemga
tykvkltnkhtaefnydegielefsqeyqeqivarig