PDB entry 4pe0

View 4pe0 on RCSB PDB site
Description: Crystal Structure of Calcium-loaded S100B bound to SBi4434
Class: metal binding protein/inhibitor
Keywords: malignant melanoma, Calcium binding, covalent inhibitor, complex, METAL BINDING PROTEIN-INHIBITOR complex
Deposited on 2014-04-22, released 2014-11-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pe0a_
  • Chain 'X':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4pe0x_
  • Heterogens: NQS, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4pe0A (A:)
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheffehe

  • Chain 'X':
    Sequence, based on SEQRES records: (download) 
    >4pe0X (X:)
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheffehe

    Sequence, based on observed residues (ATOM records): (download) 
    >4pe0X (X:)
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheff