PDB entry 4pdx

View 4pdx on RCSB PDB site
Description: Crystal structure of Escherchia coli uncharacterized protein YjcS
Class: hydrolase
Keywords: alkylsulfatase
Deposited on 2014-04-22, released 2015-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative alkyl/aryl-sulfatase YjcS
    Species: Escherichia coli [TaxId:83333]
    Gene: yjcS, b4083, JW5721
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32717 (0-631)
      • expression tag (632-634)
    Domains in SCOPe 2.06: d4pdxa1, d4pdxa2, d4pdxa3
  • Chain 'B':
    Compound: Putative alkyl/aryl-sulfatase YjcS
    Species: Escherichia coli [TaxId:83333]
    Gene: yjcS, b4083, JW5721
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32717 (0-631)
      • expression tag (632-634)
    Domains in SCOPe 2.06: d4pdxb1, d4pdxb2, d4pdxb3
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pdxA (A:)
    keeakaatqytqqvnqnyakslpfsdrqdfddaqrgfiaplldegilrdangkvyyradd
    ykfdinaaapetvnpslwrqsqingisglfkvtdkmyqvrgqdisnitfvegekgiivid
    plvtppaakaaldlyfqhrpqkpivaviythshtdhyggvkgiiseadvksgkvqviapa
    gfmdeaisenvlagnimsrralysyglllphnaqgnvgnglgvtlatgdpsiiaptktiv
    rtgekmiidglefdflmtpgseapaemhfyipalkalctaenathtlhnfytlrgaktrd
    tskwteylnetldmwgndaevlfmphtwpvwgnkhindyigkyrdtikyihdqtlhlanq
    gytmneigdmiklppalannwasrgyygsvshnaravynfylgyydgnpanlhpygqvem
    gkryvqalggsarvinlaqeankqgdyrwsaellkqviaanpgdqvaknlqannfeqlgy
    qaesatwrgfyltgakelregvhkfshgttgspdtirgmsvemlfdfmavrldsakaagk
    nislnfnmsngdnlnltlndsvlnyrktlqpqadasfyisredlhavltgqakmadlvka
    kkakiigngakleeiiacldnfdlwvnivtpnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pdxA (A:)
    keeakaatqytqqvnqnyakslpfsdrqdfddaqrgfiaplldegilrdangkvyyradd
    ykfdinaaapetvnpslwrqsqingisglfkvtdkmyqvrgqdisnitfvegekgiivid
    plvtppaakaaldlyfqhrpqkpivaviythshtdhyggvkgiiseadvksgkvqviapa
    gfmdeaisenvlagnimsrralysyglllphnaqgnvgnglgvtlatgdpsiiaptktiv
    rtgekmiidglefdflmtpaemhfyipalkalctaenathtlhnfytlrgaktrdtskwt
    eylnetldmwgndaevlfmphtwpvwgnkhindyigkyrdtikyihdqtlhlanqgytmn
    eigdmiklppalannwasrgyygsvshnaravynfylgyydgnpanlhpygqvemgkryv
    qalggsarvinlaqeankqgdyrwsaellkqviaanpgdqvaknlqannfeqlgyqaesa
    twrgfyltgakelregvhkfdtirgmsvemlfdfmavrldsakaagknislnfnmsngdn
    lnltlndsvlnyrktlqpqadasfyisredlhavltgqakmadlvkakkakiigngakle
    eiiacldnfdlwvnivtpnleh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pdxB (B:)
    keeakaatqytqqvnqnyakslpfsdrqdfddaqrgfiaplldegilrdangkvyyradd
    ykfdinaaapetvnpslwrqsqingisglfkvtdkmyqvrgqdisnitfvegekgiivid
    plvtppaakaaldlyfqhrpqkpivaviythshtdhyggvkgiiseadvksgkvqviapa
    gfmdeaisenvlagnimsrralysyglllphnaqgnvgnglgvtlatgdpsiiaptktiv
    rtgekmiidglefdflmtpgseapaemhfyipalkalctaenathtlhnfytlrgaktrd
    tskwteylnetldmwgndaevlfmphtwpvwgnkhindyigkyrdtikyihdqtlhlanq
    gytmneigdmiklppalannwasrgyygsvshnaravynfylgyydgnpanlhpygqvem
    gkryvqalggsarvinlaqeankqgdyrwsaellkqviaanpgdqvaknlqannfeqlgy
    qaesatwrgfyltgakelregvhkfshgttgspdtirgmsvemlfdfmavrldsakaagk
    nislnfnmsngdnlnltlndsvlnyrktlqpqadasfyisredlhavltgqakmadlvka
    kkakiigngakleeiiacldnfdlwvnivtpnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pdxB (B:)
    keeakaatqytqqvnqnyakslpfsdrqdfddaqrgfiaplldegilrgkvyyraddykf
    dinaaapetvnpslwrqsqingisglfkvtdkmyqvrgqdisnitfvegekgiividplv
    tppaakaaldlyfqhrpqkpivaviythshtdhyggvkgiiseadvksgkvqviapagfm
    deaisenvlagnimsrralysyglllphnaqgnvgnglgvtlatgdpsiiaptktivrtg
    ekmiidglefdflmtpaemhfyipalkalctaenathtlhnfytlrgaktrdtskwteyl
    netldmwgndaevlfmphtwpvwgnkhindyigkyrdtikyihdqtlhlanqgytmneig
    dmiklppalannwasrgyygsvshnaravynfylgyydgnpanlhpygqvemgkryvqal
    ggsarvinlaqeankqgdyrwsaellkqviaanpgdqvaknlqannfeqlgyqaesatwr
    gfyltgakelregvhkfdtirgmsvemlfdfmavrldsakaagknislnfnmsngdnlnl
    tlndsvlnyrktlqpqadasfyisredlhavltgqakmadlvkakkakiigngakleeii
    acldnfdlwvnivtpnleh