PDB entry 4pdo

View 4pdo on RCSB PDB site
Description: Structure of Ephrin type-A receptor 2
Class: transferase
Keywords: EphA2, TRANSFERASE
Deposited on 2014-04-19, released 2014-05-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.162
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA2, ECK
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA2, ECK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pdob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pdoB (B:)
    mgsshhhhhhsqdphtyedpnqavlkftteihpscvtrqkvigagefgevykgmlktssg
    kkevpvaiktlkagytekqrvdflgeagimgqfshhniirlegviskykpmmiiteymen
    galdkflrekdgefsvlqlvgmlrgiaagmkylanmnyvhrdlaarnilvnsnlvckvsd
    fglsrvleddpeatyttsggkipirwtapeaisyrkftsasdvwsfgivmwevmtygerp
    ywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqerarrpkfadivsildklir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pdoB (B:)
    dphtyedpnqavlkftteihpscvtrqkvigafgevykgmlktevpvaiktlkagytekq
    rvdflgeagimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlql
    vgmlrgiaagmkylanmnyvhrdlaarnilvnsnlvckvsdfgkipirwtapeaisyrkf
    tsasdvwsfgivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcw
    qqerarrpkfadivsildkli