PDB entry 4pdm

View 4pdm on RCSB PDB site
Description: crystal structure of k+ selective nak mutant in rubidium
Deposited on 2014-04-19, released 2014-07-09
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_0669
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81HW2 (Start-92)
      • engineered mutation (48)
      • engineered mutation (50)
      • expression tag (93-95)
  • Chain 'B':
    Compound: Potassium channel protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_0669
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81HW2 (2-92)
      • expression tag (1)
      • engineered mutation (48)
      • engineered mutation (50)
      • expression tag (93-96)
  • Heterogens: RB, MPD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4pdmA (A:)
    makdkefqvlfvltiltlisgtifystveglrpidalyfsvvtlttvgygdfspqtdfgk
    iftilyifigiglvfgfihklavnvqlpsilsnlvpr
    

    Sequence, based on observed residues (ATOM records):
    >4pdmA (A:)
    dkefqvlfvltiltlisgtifystveglrpidalyfsvvtlttvgygdfspqtdfgkift
    ilyifigiglvfgfihklavnvqlpsilsnlvp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4pdmB (B:)
    makdkefqvlfvltiltlisgtifystveglrpidalyfsvvtlttvgygdfspqtdfgk
    iftilyifigiglvfgfihklavnvqlpsilsnlvpr
    

    Sequence, based on observed residues (ATOM records):
    >4pdmB (B:)
    akdkefqvlfvltiltlisgtifystveglrpidalyfsvvtlttvgygdfspqtdfgki
    ftilyifigiglvfgfihklavnvqlpsilsnlvpr