PDB entry 4pcy

View 4pcy on RCSB PDB site
Description: crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values
Class: electron transport protein(cuproprotein)
Keywords: electron transport protein(cuproprotein)
Deposited on 1986-09-02, released 1987-01-15
The last revision prior to the SCOP 1.75 freeze date was dated 1991-01-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.15
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plastocyanin
  Species: Populus nigra
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00299 (0-98)
  Domains in SCOP 1.75: d4pcya_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4pcyA (A:)
  idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
  dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn