PDB entry 4pcy

View 4pcy on RCSB PDB site
Description: crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values
Deposited on 1986-09-02, released 1987-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.15 Å
R-factor: 0.15
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d4pcy__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pcy_ (-)
    idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
    dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn