PDB entry 4pcy

View 4pcy on RCSB PDB site
Description: crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values
Class: electron transport protein(cuproprotein)
Keywords: electron transport protein(cuproprotein)
Deposited on 1986-09-02, released 1987-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plastocyanin
  Species: Populus nigra [TaxId:3691]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00299 (0-98)
  Domains in SCOPe 2.08: d4pcya_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4pcyA (A:)
  idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
  dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn