PDB entry 4pcv

View 4pcv on RCSB PDB site
Description: The structure of BdcA (YjgI) from E. coli
Class: oxidoreductase
Keywords: NADP(H) oxidoreductase, OXIDOREDUCTASE
Deposited on 2014-04-16, released 2015-03-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BdcA (YjgI)
    Species: Escherichia coli P0299438.9 [TaxId:1116044]
    Gene: ECP02994389_4551
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4pcva_
  • Chain 'B':
    Compound: BdcA (YjgI)
    Species: Escherichia coli P0299438.9 [TaxId:1116044]
    Gene: ECP02994389_4551
    Database cross-references and differences (RAF-indexed):
    • Uniprot N3A304 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d4pcvb_
  • Heterogens: PGE, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pcvA (A:)
    ghmgaftgktvlilggsrgigaaivrrfvtdganvrftyagskdaakrlaqetgatavft
    dsadrdavidvvrksgaldilvvnagigvfgealelnaddidrlfkinihapyhasveaa
    rqmpeggriliigsvngdrmpvagmaayaasksalqgmarglardfgprgitinvvqpgp
    idtdanpangpmrdmlhslmaikrhgqpeevagmvawlagpeasfvtgamhtidgafgag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pcvA (A:)
    gaftgktvlilggsrgigaaivrrfvtdganvrftyagskdaakrlaqetgatavftdsa
    drdavidvvrksgaldilvvnaginaddidrlfkinihapyhasveaarqmpeggrilii
    gsvmaayaasksalqgmarglardfgprgitinvvqpgpgqpeevagmvawlagpeasfv
    tgamhti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4pcvB (B:)
    ghmgaftgktvlilggsrgigaaivrrfvtdganvrftyagskdaakrlaqetgatavft
    dsadrdavidvvrksgaldilvvnagigvfgealelnaddidrlfkinihapyhasveaa
    rqmpeggriliigsvngdrmpvagmaayaasksalqgmarglardfgprgitinvvqpgp
    idtdanpangpmrdmlhslmaikrhgqpeevagmvawlagpeasfvtgamhtidgafgag
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pcvB (B:)
    hmgaftgktvlilggsrgigaaivrrfvtdganvrftyagskdaakrlaqetgatavftd
    sadrdavidvvrksgaldilvvnagalelnaddidrlfkinihapyhasveaarqmpegg
    riliigsvngmaayaasksalqgmarglardfgprgitinvvqpeevagmvawlagpeas
    fvtgamhti