PDB entry 4pck

View 4pck on RCSB PDB site
Description: crystal structure of the p22s mutant of n-terminal cs domain of human shq1
Deposited on 2014-04-15, released 2015-01-14
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein SHQ1 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: SHQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PI26 (14-End)
      • expression tag (0-8)
      • expression tag (12-13)
      • engineered mutation (35)
  • Chain 'B':
    Compound: Protein SHQ1 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: SHQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PI26 (14-End)
      • expression tag (1-8)
      • expression tag (13)
      • engineered mutation (35)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4pckA (A:)
mahhhhhhvddddkmltpafdlsqdpdfltiairvsyarvsefdvyfegsdfkfyakpyf
lrltlpgrivengseqgsydadkgiftirlpketpgqhfeglnmltalla

    Sequence, based on observed residues (ATOM records):
    >4pckA (A:)
mahhhhhhvdkmltpafdlsqdpdfltiairvsyarvsefdvyfegsdfkfyakpyflrl
tlpgrivengseqgsydadkgiftirlpketpgqhfeglnmltall

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4pckB (B:)
mahhhhhhvddddkmltpafdlsqdpdfltiairvsyarvsefdvyfegsdfkfyakpyf
lrltlpgrivengseqgsydadkgiftirlpketpgqhfeglnmltalla

    Sequence, based on observed residues (ATOM records):
    >4pckB (B:)
ahhhhhhvkmltpafdlsqdpdfltiairvsyarvsefdvyfegsdfkfyakpyflrltl
pgrivengseqgsydadkgiftirlpketpgqhfeglnmltall