PDB entry 4pbw

View 4pbw on RCSB PDB site
Description: Crystal structure of chicken receptor protein tyrosine phosphatase sigma in complex with TrkC
Class: signaling protein
Keywords: Receptor protein tyrosine phosphatase (RPTP), Synapse Cell signalling Cell surface receptor, signaling protein
Deposited on 2014-04-14, released 2014-11-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.227
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NT-3 growth factor receptor
    Species: Gallus gallus [TaxId:9031]
    Gene: NTRK3, TRKC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91044 (3-273)
      • expression tag (1-2)
      • engineered mutation (43)
      • engineered mutation (134)
      • engineered mutation (203)
      • engineered mutation (230)
      • engineered mutation (238)
      • engineered mutation (265)
  • Chain 'B':
    Compound: NT-3 growth factor receptor
    Species: Gallus gallus [TaxId:9031]
    Gene: NTRK3, TRKC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91044 (3-273)
      • expression tag (2)
      • engineered mutation (43)
      • engineered mutation (134)
      • engineered mutation (203)
      • engineered mutation (230)
      • engineered mutation (238)
      • engineered mutation (265)
  • Chain 'C':
    Compound: NT-3 growth factor receptor
    Species: Gallus gallus [TaxId:9031]
    Gene: NTRK3, TRKC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91044 (3-273)
      • expression tag (2)
      • engineered mutation (134)
      • engineered mutation (203)
      • engineered mutation (230)
      • engineered mutation (238)
      • engineered mutation (265)
  • Chain 'D':
    Compound: protein-tyrosine phosphatase crypalpha1 isoform
    Species: Gallus gallus [TaxId:9031]
    Gene: CRYPalpha1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pbwd1, d4pbwd2
  • Chain 'E':
    Compound: protein-tyrosine phosphatase crypalpha1 isoform
    Species: Gallus gallus [TaxId:9031]
    Gene: CRYPalpha1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pbwe1, d4pbwe2
  • Chain 'F':
    Compound: protein-tyrosine phosphatase crypalpha1 isoform
    Species: Gallus gallus [TaxId:9031]
    Gene: CRYPalpha1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4pbwf1, d4pbwf2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4pbwD (D:)
    etgesppvfikkpvdqigvsggvasfvcqatgdpkprvtwnkkgkkvnsqrfetiefdes
    agavlriqplrtprdeniyecvaqnphgevtvhakltvlredqlppgfpnidmgpqlkvv
    ertrtatmlcaasgnpdpeitwfkdflpvdpstsngrikqlrsgglqiesseetdqgkye
    cvasnsagvrysspanlyvrvrrvaprfsilpvsheimpggnvnitcvavgspmpyvkwm
    qgaedltpeddmpvgrnvleltdvkdsanytcvamsslgvieavaqitvkskghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pbwD (D:)
    esppvfikkpvdqigvsggvasfvcqatgdpkprvtwnvnsqrfetiefdesagavlriq
    plrtprdeniyecvaqnphgevtvhakltvlredqlppgfpnidmgpqlkvvertrtatm
    lcaasgnpdpeitwfkdflpvdpstsngrikqlrsgglqiesseetdqgkyecvasnsag
    vrysspanlyvrv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4pbwE (E:)
    etgesppvfikkpvdqigvsggvasfvcqatgdpkprvtwnkkgkkvnsqrfetiefdes
    agavlriqplrtprdeniyecvaqnphgevtvhakltvlredqlppgfpnidmgpqlkvv
    ertrtatmlcaasgnpdpeitwfkdflpvdpstsngrikqlrsgglqiesseetdqgkye
    cvasnsagvrysspanlyvrvrrvaprfsilpvsheimpggnvnitcvavgspmpyvkwm
    qgaedltpeddmpvgrnvleltdvkdsanytcvamsslgvieavaqitvkskghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pbwE (E:)
    esppvfikkpvdqigvsggvasfvcqatgdpkprvtwnvnsqrfetiefdesagavlriq
    plrtprdeniyecvaqnphgevtvhakltvlredqlppgfpnidmgpqlkvvertrtatm
    lcaasgnpdpeitwfkdflpvdpstsngrikqlrsgglqiesseetdqgkyecvasnsag
    vrysspanlyvrvr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4pbwF (F:)
    etgesppvfikkpvdqigvsggvasfvcqatgdpkprvtwnkkgkkvnsqrfetiefdes
    agavlriqplrtprdeniyecvaqnphgevtvhakltvlredqlppgfpnidmgpqlkvv
    ertrtatmlcaasgnpdpeitwfkdflpvdpstsngrikqlrsgglqiesseetdqgkye
    cvasnsagvrysspanlyvrvrrvaprfsilpvsheimpggnvnitcvavgspmpyvkwm
    qgaedltpeddmpvgrnvleltdvkdsanytcvamsslgvieavaqitvkskghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pbwF (F:)
    esppvfikkpvdqigvsggvasfvcqatgdpkprvtwnvnsqrfetiefdesagavlriq
    plrtprdeniyecvaqnphgevtvhakltvlredqlppgfpnidmgpqlkvvertrtatm
    lcaasgnpdpeitwfkdflpvdpstsngrikqlrsgglqiesseetdqgkyecvasnsag
    vrysspanlyvr