PDB entry 4pbp

View 4pbp on RCSB PDB site
Description: crystal structure of zebrafish short-chain pentraxin protein
Class: immune system
Keywords: acute phase protein, pentraxin
Deposited on 2014-04-13, released 2015-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-reactive protein
    Species: Danio rerio [TaxId:7955]
    Gene: crp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4pbpa_
  • Chain 'B':
    Compound: c-reactive protein
    Species: Danio rerio [TaxId:7955]
    Gene: crp
    Database cross-references and differences (RAF-indexed):
    • Uniprot G9D324 (3-209)
      • initiating methionine (0)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d4pbpb_
  • Chain 'C':
    Compound: c-reactive protein
    Species: Danio rerio [TaxId:7955]
    Gene: crp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4pbpc_
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pbpA (A:)
    meffknlsgkvlqfktatdnsyvklypekplslsaftlcmrvatelpldrevilfayytp
    dvdelnvwrerdgrvslyiqsskdaaffrlpplstlqthlcvawesatgltafwmdgrrs
    lhqvyrkgysirsggtvvlgqdpdsyvgsfdvdqsfvgeianlqmwdyvlssaqikavyy
    nqdnrvkgnvfdwdtieydvtgnvlvvpdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pbpA (A:)
    knlsgkvlqfktatdnsyvklypekplslsaftlcmrvatelpldrevilfayytpdvde
    lnvwrerdgrvslyiqsskdaaffrlpplstlqthlcvawesatgltafwmdgrrslhqv
    yrkgysirsggtvvlgqdpdsyvgsfdvdqsfvgeianlqmwdyvlssaqikavyynqdn
    rvkgnvfdwdtieydvtgnvlvvpdn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4pbpB (B:)
    meffknlsgkvlqfktatdnsyvklypekplslsaftlcmrvatelpldrevilfayytp
    dvdelnvwrerdgrvslyiqsskdaaffrlpplstlqthlcvawesatgltafwmdgrrs
    lhqvyrkgysirsggtvvlgqdpdsyvgsfdvdqsfvgeianlqmwdyvlssaqikavyy
    nqdnrvkgnvfdwdtieydvtgnvlvvpdn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4pbpC (C:)
    meffknlsgkvlqfktatdnsyvklypekplslsaftlcmrvatelpldrevilfayytp
    dvdelnvwrerdgrvslyiqsskdaaffrlpplstlqthlcvawesatgltafwmdgrrs
    lhqvyrkgysirsggtvvlgqdpdsyvgsfdvdqsfvgeianlqmwdyvlssaqikavyy
    nqdnrvkgnvfdwdtieydvtgnvlvvpdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pbpC (C:)
    fknlsgkvlqfktatdnsyvklypekplslsaftlcmrvatelpldrevilfayytpdvd
    elnvwrerdgrvslyiqsskdaaffrlpplstlqthlcvawesatgltafwmdgrrslhq
    vyrkgysirsggtvvlgqdpdsyvgsfdvdqsfvgeianlqmwdyvlssaqikavyynqd
    nrvkgnvfdwdtieydvtgnvlvvpdn