PDB entry 4pbo

View 4pbo on RCSB PDB site
Description: Crystal structure of zebrafish short-chain pentraxin protein without calcium ions
Class: immune system
Keywords: acute phase protein, pentraxin, IMMUNE SYSTEM
Deposited on 2014-04-13, released 2015-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-reactive protein
    Species: Danio rerio [TaxId:7955]
    Gene: crp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4pboa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4pboA (A:)
fknlsgkvlqfktatdnsyvklypekplslsaftlcmrvatelpldrevilfayytpdvd
elnvwrerdgrvslyiqsskdaaffrlpplstlqthlcvawesatgltafwmdgrrslhq
vyrkgysirsggtvvlgqdpdsyvgsfdvdqsfvgeianlqmwdyvlssaqikavyynqd
nrvkgnvfdwdtieydvtgnvlvvpdn