PDB entry 4paz

View 4paz on RCSB PDB site
Description: oxidized mutant p80a pseudoazurin from a. faecalis
Deposited on 1997-02-20, released 1997-08-20
The last revision prior to the SCOP 1.57 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.164
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d4paz__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4paz_ (-)
    enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
    nenyvltvtqpgaylvkctahyamgmialiavgdspanldqivsakkpkivqerlekvia
    sak