PDB entry 4pal

View 4pal on RCSB PDB site
Description: ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Class: calcium binding protein
Keywords: calcium binding protein
Deposited on 1990-11-08, released 1992-01-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parvalbumin
    Species: Esox lucius
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d4pala_
  • Heterogens: MG, CA, ACE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4palA (A:)
    sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
    elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika