PDB entry 4pac

View 4pac on RCSB PDB site
Description: Crystal Structure of Histidine-containing Phosphotransfer Protein AHP2 from Arabidopsis thaliana
Class: signaling protein
Keywords: cytokinin signaling, helical fold, signaling protein
Deposited on 2014-04-08, released 2015-05-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine-containing phosphotransfer protein 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AHP2, ATHP1, At3g29350, MUO10.6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZNV8 (44-End)
      • expression tag (41-43)
    Domains in SCOPe 2.05: d4paca_
  • Heterogens: MES, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4pacA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpssrsaagtmefmdaliaqlqrqfrdyt
    islyqqgflddqftelkklqddgspdfvsevlslffedcvklisnmaraldttgtvdfsq
    vgasvhqlkgssssvgakrvktlcvsfkecceaknyegcvrclqqvdieykalktklqdm
    fnlekqiiqaggivpqvdin
    

    Sequence, based on observed residues (ATOM records): (download)
    >4pacA (A:)
    mefmdaliaqlqrqfrdytislyqqgflddqftelkklqdpdfvsevlslffedcvklis
    nmaraldttgtvdfsqvgasvhqlkgssssvgakrvktlcvsfkecceaknyegcvrclq
    qvdieykalktklqdmfnlekqiiqaggivpqv