PDB entry 4p9v

View 4p9v on RCSB PDB site
Description: grb2 sh2 complexed with a ptyr-ac6cn-asn tripeptide
Deposited on 2014-04-06, released 2014-06-18
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: phq-ptr-02k-asn-nh2
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 4P9V (0-End)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4p9vA (A:)
iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqahhhhhh

    Sequence, based on observed residues (ATOM records):
    >4p9vA (A:)
emkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrd
gagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >4p9vB (B:)
xyxn