PDB entry 4p9h

View 4p9h on RCSB PDB site
Description: Crystal structure of 8ANC195 Fab in complex with gp120 of 93TH057 HIV-1 and soluble CD4 D1D2
Class: viral protein/immune system
Keywords: IG FOLD, ANTI HIV, ANTIBODY, IMMUNE SYSTEM COMPLEX, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2014-04-04, released 2014-05-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.237
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: T-cell surface glycoprotein cd4
    Species: Homo sapiens [TaxId:9606]
    Gene: CD4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01730
      • engineered mutation (74)
    Domains in SCOPe 2.04: d4p9hc1, d4p9hc2
  • Chain 'G':
    Compound: envelope glycoprotein gp120
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0ED31 (0-79)
      • engineered mutation (21)
      • engineered mutation (44)
      • engineered mutation (71)
      • linker (80-81)
    • Uniprot Q0ED31 (82-184)
      • engineered mutation (172)
    • Uniprot Q0ED31
      • engineered mutation (201)
      • engineered mutation (258)
      • engineered mutation (308)
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4P9H (0-End)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4P9H (0-End)
    Domains in SCOPe 2.04: d4p9hl1, d4p9hl2
  • Heterogens: EPE, BAM, NAG

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4p9hC (C:)
    kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
    lwdqgnfpliiknltiedsdtyicevedqkeevqllvfgltansdthllqgqsltltles
    ppgsspsvqcrsprgkniqggktlsvsqlelqdsgtwtctvlqnqkkvefkidivvlafq
    kaidgrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p9hC (C:)
    kvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrsl
    wdqgnfpliiknltiedsdtyicevedqkeevqllvfgltansdqsltltlesppgssps
    vqcrsprgkniqggktlsvsqldsgtwtctvlqnqkkvefkidivvl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4p9hL (L:)
    diqmtqspstlsasigdtvriscrasqsitgnwvawyqqrpgkaprlliyrgaallggvp
    srfsgsaagtdftltignlqaedfgtfycqqydtypgtfgqgtkvevkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p9hL (L:)
    diqmtqspstlsasigdtvriscrasqsitgnwvawyqqrpgkaprlliyrgaallggvp
    srfsgsaagtdftltignlqaedfgtfycqqydtypgtfgqgtkvevkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnr