PDB entry 4p91

View 4p91 on RCSB PDB site
Description: Crystal structure of the nogo-receptor-2 (27-330)
Class: membrane protein
Keywords: nogo receptor, glycosylation, MEMBRANE PROTEIN
Deposited on 2014-04-01, released 2014-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-30, with a file datestamp of 2014-04-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.16
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Reticulon-4 receptor-like 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rtn4rl2, Ngrh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p91a_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p91A (A:)
    pscpmlctcysspptvscqannfssvplslppstqrlflqnnlirslrpgtfgpnlltlw
    lfsnnlstiypgtfrhlqaleeldlgdnrhlrslepdtfqglerlqslhlyrcqlsslpg
    nifrglvslqylylqensllhlqddlfadlanlshlflhgnrlrlltehvfrglgsldrl
    llhgnrlqgvhraafhglsrltilylfnnslaslpgealadlpaleflrlnanpwacdcr
    arplwawfqrarvsssdvtcatpperqgrdlrtlrdtdfqacppptptrpgsrargnsss
    nh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p91A (A:)
    pscpmlctcysspptvscqannfssvplslppstqrlflqnnlirslrpgtfgpnlltlw
    lfsnnlstiypgtfrhlqaleeldlgdnrhlrslepdtfqglerlqslhlyrcqlsslpg
    nifrglvslqylylqensllhlqddlfadlanlshlflhgnrlrlltehvfrglgsldrl
    llhgnrlqgvhraafhglsrltilylfnnslaslpgealadlpaleflrlnanpwacdcr
    arplwawfqrarvsssdvtcatpperqgrdlrtlrdtdfqacpppt