PDB entry 4p8j

View 4p8j on RCSB PDB site
Description: Structure of ribB
Class: lyase
Keywords: ribB, riboflvain, crystal, DHBPS, Ru5P, LYASE
Deposited on 2014-03-31, released 2015-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Vibrio cholerae serotype O1 [TaxId:243277]
    Gene: ribB, VC_A1060
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p8ja_
  • Chain 'B':
    Compound: 3,4-dihydroxy-2-butanone 4-phosphate synthase
    Species: Vibrio cholerae serotype O1 [TaxId:243277]
    Gene: ribB, VC_A1060
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p8jb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p8jA (A:)
    mgshhhhhhssglvprgshmnqssllaefgdpitrvenalqalregrgvlllddedrene
    gdiiyaveslttaqmalmirecsgivclclteaqadrlalppmvvnnnsanqtaftvsie
    akhgvttgvsaqdrvttiktaanpqakpedlarpghvfplraraggvlarrghtegtvdl
    mqmaglqpagvlceltnpdgsmaktpeiiefgklhnmpvltiedmvqyriqfdlkla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p8jA (A:)
    ssllaefgdpitrvenalqalregrgvlllddedrenegdiiyaveslttaqmalmirec
    sgivclclteaqadrlalpvsieakhgvttgvsaqdrvttiktaanpqakpedlarpghv
    fplraraggvlarrghtegtvdlmqmaglqpagvlceltnpdgsmaktpeiiefgklhnm
    pvltiedmvqyriqfdlkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4p8jB (B:)
    mgshhhhhhssglvprgshmnqssllaefgdpitrvenalqalregrgvlllddedrene
    gdiiyaveslttaqmalmirecsgivclclteaqadrlalppmvvnnnsanqtaftvsie
    akhgvttgvsaqdrvttiktaanpqakpedlarpghvfplraraggvlarrghtegtvdl
    mqmaglqpagvlceltnpdgsmaktpeiiefgklhnmpvltiedmvqyriqfdlkla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p8jB (B:)
    ssllaefgdpitrvenalqalregrgvlllddedrenegdiiyaveslttaqmalmirec
    sgivclclteaqadrlalppmvtaftvsieakhgvttgvsaqdrvttiktaanpqakped
    larpghvfplraraggvlarrghtegtvdlmqmaglqpagvlceltnpdgsmaktpeiie
    fgklhnmpvltiedmvqyriqfdlkla