PDB entry 4p84

View 4p84 on RCSB PDB site
Description: Structure of engineered PyrR protein (VIOLET PyrR)
Deposited on 2014-03-30, released 2014-12-17
The last revision was dated 2014-12-31, with a file datestamp of 2014-12-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein PyrR
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 4P84 (0-179)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4p84A (A:)
gsnekavildeqairraltriaheiiernkgvdncvlvgiktrgiylakrlaerieqieg
kpvpvgeiditlyrddlsvtsndeplvkgtdipvditdkkvilvddvlytgrtvragmda
lmdlgrpsqiqlavlvdrghrelpiradyvgknvptskserivvqldevdqndrvsiyen