PDB entry 4p7f

View 4p7f on RCSB PDB site
Description: Mouse apo-COMT
Class: transferase
Keywords: methyltransferase, neurotransmitter degradation, transferase, alternative initiation, catecholamine metabolism, cell membrane, metal-binding, phosphoprotein, s-adenosyl-l-methionine, signal-anchor, transmembrane anchor, enzyme mechanism, conformational change
Deposited on 2014-03-27, released 2014-06-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.126
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Comt, Comt1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88587
      • conflict (118)
    Domains in SCOPe 2.07: d4p7fa_
  • Heterogens: NA, PO4, PI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p7fA (A:)
    mggtkeqrilrhvqqhakpgdpqsvleaidtycsekewamnvgdakgqimdavireyrps
    lvlelgaycgysavrmarllppgarlltmeinpdyaaitqqmldfaglqdkvsiligapq
    dlipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvivpgtpdfl
    ayvrgsssfecthyssyleymkvvdglekavyqgpgsspvks
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p7fA (A:)
    gtkeqrilrhvqqhakpgdpqsvleaidtycsekewamnvgdakgqimdavireyrpslv
    lelgaycgysavrmarllppgarlltmeinpdyaaitqqmldfaglqdkvsiligapqdl
    ipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvivpgtpdflay
    vrgsssfecthyssyleymkvvdglekavyqgp