PDB entry 4p76

View 4p76 on RCSB PDB site
Description: Cellular response to a crystal-forming protein
Class: luminescent protein
Keywords: luminescent protein
Deposited on 2014-03-26, released 2015-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: photoconvertible fluorescent protein
    Species: Favia favus [TaxId:102203]
    Gene: KikGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53UG8 (2-End)
      • cloning artifact (1)
      • chromophore (64)
      • engineered mutation (197)
    Domains in SCOPe 2.06: d4p76a1, d4p76a2
  • Chain 'B':
    Compound: photoconvertible fluorescent protein
    Species: Favia favus [TaxId:102203]
    Gene: KikGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53UG8 (2-End)
      • chromophore (64)
      • engineered mutation (197)
    Domains in SCOPe 2.06: d4p76b_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p76A (A:)
    mvsvitsemkielrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdiltt
    afhygnrvfveypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvn
    eirfdgvnfpangpvmqrktvkwepstekmyvrdgvlkgdvnmalllqggghyrcdfrtt
    ykakkvvqlpdyhfvdhsmeitshdkdynkvklyehakahsglprlak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p76A (A:)
    vsvitsemkielrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdiltta
    fhygnrvfveypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvne
    irfdgvnfpangpvmqrktvkwepstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
    kakkvvqlpdyhfvdhsmeitshdkdynkvklyehakahsglprla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4p76B (B:)
    mvsvitsemkielrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdiltt
    afhygnrvfveypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvn
    eirfdgvnfpangpvmqrktvkwepstekmyvrdgvlkgdvnmalllqggghyrcdfrtt
    ykakkvvqlpdyhfvdhsmeitshdkdynkvklyehakahsglprlak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p76B (B:)
    svitsemkielrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdilttaf
    hygnrvfveypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvnei
    rfdgvnfpangpvmqrktvkwepstekmyvrdgvlkgdvnmalllqggghyrcdfrttyk
    akkvvqlpdyhfvdhsmeitshdkdynkvklyehakahsglp