PDB entry 4p6w

View 4p6w on RCSB PDB site
Description: crystal structure of mometasone furoate-bound glucocorticoid receptor ligand binding domain
Deposited on 2014-03-25, released 2014-04-16
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04150 (0-251)
      • engineered mutation (76)
      • engineered mutation (96)
      • engineered mutation (142)
      • engineered mutation (148-149)
      • engineered mutation (173)
      • engineered mutation (177)
  • Chain 'B':
    Compound: nuclear receptor coactivator 2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15596 (0-11)
      • engineered mutation (0)
  • Heterogens: MOF, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4p6wA (A:)
pqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfr
nlhlddqmtllqyswmalmafalgwrsyrqssanllyfapdliineqrmtlpcmydqckh
mlyvsselhrlqvsyeeylcmkvllllstipkdglksqelfdeirmtyikelgaaivare
gnssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkys
ngnikkllfhqk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >4p6wB (B:)
anallrylldkd