PDB entry 4p66

View 4p66 on RCSB PDB site
Description: Electrostatics of Active Site Microenvironments of E. coli DHFR
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, catalysis, electrostatics, catalytic cycle
Deposited on 2014-03-21, released 2014-07-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Gene: folA, ECs0051, LF82_0721
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3TR70 (0-158)
      • engineered mutation (45)
      • engineered mutation (84)
      • engineered mutation (151)
    Domains in SCOPe 2.08: d4p66a_
  • Heterogens: MTX, NAP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4p66A (A:)
misliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhxwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaaagdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsysfeilerr