PDB entry 4p61

View 4p61 on RCSB PDB site
Description: chicken triosephosphate isomerase with loop6 mutations, v167p and w168e.
Class: isomerase
Keywords: triosephosphate isomerase, isomerase
Deposited on 2014-03-21, released 2014-08-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-27, with a file datestamp of 2014-08-22.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.166
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Gallus gallus [TaxId:9031]
    Gene: TPI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00940 (Start-247)
      • engineered mutation (166-167)
    Domains in SCOPe 2.06: d4p61a_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Gallus gallus [TaxId:9031]
    Gene: TPI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00940 (Start-247)
      • engineered mutation (166)
    Domains in SCOPe 2.06: d4p61b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p61A (A:)
    maprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakig
    vaaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeg
    lgviacigekldereagitekvvfeqtkaiadnvkdwskvvlayeppeaigtgktatpqq
    aqevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpef
    vdiinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p61A (A:)
    prkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigva
    aqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeglg
    viacigekldereagitekvvfeqtkaiadnvkdwskvvlayeppeaigtatpqqaqevh
    eklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdiin
    akh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4p61B (B:)
    maprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakig
    vaaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeg
    lgviacigekldereagitekvvfeqtkaiadnvkdwskvvlayeppeaigtgktatpqq
    aqevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpef
    vdiinakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p61B (B:)
    aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
    aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
    gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayeppatpqqaqevheklr
    gwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdiinakh