PDB entry 4p5s

View 4p5s on RCSB PDB site
Description: Structure of reduced W45Y mutant of amicyanin
Class: electron transport
Keywords: Type-I blue copper protein, Beta sandwich, Electron transport
Deposited on 2014-03-19, released 2014-04-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: 0.135
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: mauC, ami
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • engineered mutation (44)
    Domains in SCOPe 2.04: d4p5sa_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4p5sA (A:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtyinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve