PDB entry 4p5r

View 4p5r on RCSB PDB site
Description: Structure of oxidized W45Y mutant of amicyanin
Class: electron transport
Keywords: Type-I blue copper protein, Beta sandwich, Electron transport
Deposited on 2014-03-19, released 2014-04-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: 0.129
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: amicyanin
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: mauC, ami
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22364 (0-104)
    • engineered mutation (44)
  Domains in SCOPe 2.04: d4p5ra_
• Heterogens: CU, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4p5rA (A:)
  dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtyinreamphnvhfvag
  vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve