PDB entry 4p58

View 4p58 on RCSB PDB site
Description: Crystal structure of mouse comt bound to an inhibitor
Class: transferase/transferase inhibitor
Keywords: SAM binding site
Deposited on 2014-03-15, released 2014-06-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.147
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Comt, Comt1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88587 (0-211)
      • conflict (8)
      • conflict (12)
      • conflict (54)
      • conflict (77)
      • conflict (100)
      • conflict (109)
      • conflict (207)
    Domains in SCOPe 2.07: d4p58a_
  • Heterogens: 2F6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p58A (A:)
    tkeqrilryvqqnakpgdpqsvleaidtycsekewamnvgdakgqimdavireyspslvl
    elgaycgysavrmarllqpgarlltmeinpdyaaitqqmlnfaglqdkvtiligasqdli
    pqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvivpgtpdflayv
    rgsssfecthyssyleymkvvdglekaiyqgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p58A (A:)
    tkeqrilryvqqnakpgdpqsvleaidtycsegdakgqimdavireyspslvlelgaycg
    ysavrmarllqpgarlltmeinpdyaaitqqmlnfaglqdkvtiligasqdlipqlkkky
    dvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvivpgtpdflayvrgsssfe
    cthyssyleymkvvdglekaiyqgp