PDB entry 4p57

View 4p57 on RCSB PDB site
Description: MHC TCR peptide complex
Class: immune system
Keywords: MHC TCR peptide Be2+ complex, Berylliosis, IMMUNE SYSTEM
Deposited on 2014-03-14, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-07, with a file datestamp of 2015-01-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.21
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DP alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPA1, HLA-DP1A, HLASB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p57a1, d4p57a2
  • Chain 'B':
    Compound: mim2 peptide,HLA class II histocompatibility antigen, DP beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPB1, HLA-DP1B
    Database cross-references and differences (RAF-indexed):
    • PDB 4P57 (0-10)
      • linker (11-16)
    • Uniprot Q5EP54 (Start-211)
      • engineered mutation (91)
  • Chain 'C':
    Compound: HLA class II histocompatibility antigen, DP alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPA1, HLA-DP1A, HLASB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4p57c1, d4p57c2
  • Chain 'D':
    Compound: mim2 peptide,HLA class II histocompatibility antigen, DP beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DPB1, HLA-DP1B
    Database cross-references and differences (RAF-indexed):
    • PDB 4P57 (0-10)
      • linker (11-15)
    • Uniprot Q5EP54 (Start-211)
      • engineered mutation (91)
  • Heterogens: NAG, GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p57A (A:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    qep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p57A (A:)
    kadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggla
    niailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvtw
    lcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwe
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4p57C (C:)
    ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
    aniailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvt
    wlcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhwea
    qep
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p57C (C:)
    kadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggla
    niailnnnlntliqrsnhtqatndppevtvfpkepvelgqpntlichidkffppvlnvtw
    lcngelvtegvaeslflprtdysfhkfhyltfvpsaedfydcrvehwgldqpllkhweaq
    

  • Chain 'D':
    No sequence available.