PDB entry 4p48

View 4p48 on RCSB PDB site
Description: The structure of a chicken anti-cardiac Troponin I scFv
Class: immune system
Keywords: recombinant antibody chicken, cardiac troponin I, scFv, immunoglobulin, phage display, immune system
Deposited on 2014-03-12, released 2014-04-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.157
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibody scFv 180
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 4P48 (0-End)
    Domains in SCOPe 2.04: d4p48a1, d4p48a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4p48A (A:)
    altqpssvsanpggtveitcsgggryydgsyyygwyqqkspgsapvtviyentkrpsnip
    srfsgsksgstatltitgvraedeavyycgsaddnmnptifgagttltvlggssrssggg
    gsggggssaltldesggglqtpggalslvckasgftfssygmqwvrqapgkglewvagiq
    nddtgtyygaavkgratisrdngqstvrlqlnnlraedtgtyycakdassdggyggdsid
    awghgtevivsstsgqagqhhhhhhgaypydvpdyas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4p48A (A:)
    altqpssvsanpggtveitcsgggryydgsyyygwyqqkspgsapvtviyentkrpsnip
    srfsgsksgstatltitgvraedeavyycgsaddnmnptifgagttltvlgaltldesgg
    glqtpggalslvckasgftfssygmqwvrqapgkglewvagiqnddtgtyygaavkgrat
    isrdngqstvrlqlnnlraedtgtyycakdassdggyggdsidawghgtevivss